USA USA: 1-631-626-9181 Europe Europe: 44-207-097-1828  
Search

Tissue samples, tissue arrays, cells, microorganisms, probes and services for your research.

Web Search    Google
Featured Products
Ordering Information

Payment methods we support:
✭ Invoice / Purchase Order
✭ Credit card

ActoFactor™ Recombinant Human Chemokine (C-X3-C motif) ligand 1

  • Specification
  • Recommended Products
Cat.No.
CSC-CTK0051
Description
Fractalkine, CX3CL1, is a novel multidomain chemokine expressed as a membrane-spanning adhesion molecule that can be cleaved from the cell surface to produce a soluble chemoattractant. Human fractalkine cDNA encodes a 397 amino acid residue membrane protein with a 24 aa residue predicted signal peptide, a 76 aa residue chemokine domain, a 241 aa residue stalk region containing 17 degenerate mucin-like repeats, a 19 aa residue transmembrane segment and a 37 aa residue cytoplasmic domain. The extracellular domain of human fractalkine can be released, possibly by proteolysis at the dibasic cleavage site proximal to the membrane, to generate soluble fractalkine. This release can be inhibited by the zinc metalloproteinase inhibitor batimastat. Fractalkine mRNA has been detected in various tissues including the brain and heart. Fractalkine is produced by endothelial cells, microglia and smooth muscle in response to inflammatory signals. Membrane-bound fractalkine has been shown to promote adhesion of leukocytes. The soluble chemokine domain of human fractalkine was reported to be chemotactic for T cells, monocytes and dendritic cells. It also induces cell survival, immunomodulation and actin polymerization. The gene for human fractalkine has been mapped to chromosome 16q. The 76 amino acid residue recombinant protein has a predicted molecular mass of approximately 8.5 kDa.
Species
Human
Product Overview
Human CX3CL1 expressed in E.coli
Sequence
A DNA sequence encoding the chemokine domain of mature human Fractalkine (amino acid residues 25 -100) (QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVK DAMQHLDRQAAALTRNG) protein sequence was expressed in E. coli.
Size
CAT# CSC-CTK0051-25 (25 μg); CAT# CSC-CTK0051-125 (125 μg)
Expression System
E.coli
Purity
Greater than 97% as determined by SDS-PAGE and visualized by silver stain
Activity
Activity was determined by ability to chemoattract freshly isolated peripheral blood lymphocytes or mouse BaF/3 cells transfected with hCX3CR-1. Typical ED50 for these effects were 2 - 5 ng/mL or 0.3 - 1.5 ng/mL, respectively.
Endotoxin Level
Endotoxin level less than 0.1 ng per 1 μg of the cytokine as determined by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered solution in 30% acetonitrile and 0.1% TFA containing 50 μg of bovine serum albumin per 1 μg of cytokine.
Reconstitution
It is recommended that sterile PBS containing at least 0.1% human serum albumin or bovine serum albumin be added to the vial to prepare a stock solution of no less than 50 μg/mL.
Storage & Stability
Lyophilized chemokines are stable for greater than six months at -20°C to -70°C. Reconstituted hCXC3L1 can be stored under sterile conditions at 2°to 4°C for one month or at -20°C to -70°C in a manual defrost freezer for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Citation Guidance
If you use this products in your scientific publication, it should be cited in the publication as: Creative Bioarray cat no. If your paper has been published, please click here to submit the Pub Med ID of your paper to get a coupon.
Customer Support & Price Inquiry
Please input "bioarray" as verification code.
CONTACT US USA
45-1 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-626-9181
Fax: 1-631-614-7828
Email: 

Europe
Tel: 44-207-097-1828
Email: