Online Inquiry & Support

USA: 1-631-626-9181   Fax: 1-631-614-7828
Europe: 44-207-097-1828
Email: info@creative-bioarray.com

ActoFactor™ Recombinant Human Chemokine (C-X3-C motif) ligand 1

Bookmark and Share
  • Specification
  • Recommended Products
  • Cat.No.
  • CSC-CTK0051
  • Description
  • Fractalkine, CX3CL1, is a novel multidomain chemokine expressed as a membrane-spanning adhesion molecule that can be cleaved from the cell surface to produce a soluble chemoattractant. Human fractalkine cDNA encodes a 397 amino acid residue membrane protein with a 24 aa residue predicted signal peptide, a 76 aa residue chemokine domain, a 241 aa residue stalk region containing 17 degenerate mucin-like repeats, a 19 aa residue transmembrane segment and a 37 aa residue cytoplasmic domain. The extracellular domain of human fractalkine can be released, possibly by proteolysis at the dibasic cleavage site proximal to the membrane, to generate soluble fractalkine. This release can be inhibited by the zinc metalloproteinase inhibitor batimastat. Fractalkine mRNA has been detected in various tissues including the brain and heart. Fractalkine is produced by endothelial cells, microglia and smooth muscle in response to inflammatory signals. Membrane-bound fractalkine has been shown to promote adhesion of leukocytes. The soluble chemokine domain of human fractalkine was reported to be chemotactic for T cells, monocytes and dendritic cells. It also induces cell survival, immunomodulation and actin polymerization. The gene for human fractalkine has been mapped to chromosome 16q. The 76 amino acid residue recombinant protein has a predicted molecular mass of approximately 8.5 kDa.
  • Species
  • Human
  • Product Overview
  • Human CX3CL1 expressed in E.coli
  • Sequence
  • A DNA sequence encoding the chemokine domain of mature human Fractalkine (amino acid residues 25 -100) (QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVK DAMQHLDRQAAALTRNG) protein sequence was expressed in E. coli.
  • Size
  • CAT# CSC-CTK0051-25 (25 μg); CAT# CSC-CTK0051-125 (125 μg)
  • Expression System
  • E.coli
  • Purity
  • Greater than 97% as determined by SDS-PAGE and visualized by silver stain
  • Activity
  • Activity was determined by ability to chemoattract freshly isolated peripheral blood lymphocytes or mouse BaF/3 cells transfected with hCX3CR-1. Typical ED50 for these effects were 2 - 5 ng/mL or 0.3 - 1.5 ng/mL, respectively.
  • Endotoxin Level
  • Endotoxin level less than 0.1 ng per 1 μg of the cytokine as determined by the LAL method.
  • Formulation
  • Lyophilized from a 0.2 μm filtered solution in 30% acetonitrile and 0.1% TFA containing 50 μg of bovine serum albumin per 1 μg of cytokine.
  • Reconstitution
  • It is recommended that sterile PBS containing at least 0.1% human serum albumin or bovine serum albumin be added to the vial to prepare a stock solution of no less than 50 μg/mL.
  • Storage & Stability
  • Lyophilized chemokines are stable for greater than six months at -20°C to -70°C. Reconstituted hCXC3L1 can be stored under sterile conditions at 2°to 4°C for one month or at -20°C to -70°C in a manual defrost freezer for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Citation Guidance:
If you use this products in your scientific publication, it should be cited in the publication as: Creative Bioarray cat no. If your paper has been published, please click here to submit the Pub Med ID of your paper to get a coupon.

Price Inquiry

Please input "bioarray" as verification code.

SEARCH

tissue samples, tissue arrays, cells, microorganisms, probes and services for your research.

  

SEARCH

Contact Us
    • USA
      45-1 Ramsey Road, Shirley, NY 11967, USA
      Tel: 1-631-626-9181
      Fax: 1-631-614-7828
      Email: info@creative-bioarray.com
      Europe
      Tel: 44-207-097-1828
      Email: info@creative-bioarray.com
Ordering Information
    • Payment methods we support:
      ✭ Invoice / Purchase Order
      ✭ Credit card
Contact Us
USA
45-1 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-626-9181
Fax: 1-631-614-7828
Email: info@creative-bioarray.com

Europe
Tel: 44-207-097-1828
Email: info@creative-bioarray.com